Trusted shipping Easy returns Secure shopping
beautyandcart

Big Flex Prime Muscle Mass Gainer, 13.2 lb Banana & Strawberry + Pharmgrade Healthy Living Ashwagandha 60 Tabs Free

Special Price £ 85.69 In stock
Option : 13.2lb, bananastrawberrypharmgradehealthylivingashwagandha60tabsfree
Big Flex

*Product availability is subject to suppliers inventory

Product Info

Product Details

  • BigFlex Prime Muscle Mass Gainer is a powerful blend of protein, carbohydrates, vitamins, minerals, and fat. This fantastic concoction energies your body and fuels you during strenuous workouts.
  • BigFlex Prime Muscle Mass Gainer contains Whey Protein Concentrate and Calcium Caseinate. They help release amino acids and act as a reliable protein source, too, thus improving muscle gains and maximizing recovery.
  • BigFlex Prime Muscle Mass Gainer contains 25 essential vitamins and minerals and a 6g essential amino acid blend. They aid the immune system to function better and also promote good bone health.

Big Flex Prime Muscle Mass Gainer, 13.2 lb Banana &; Strawberry + Pharmgrade Healthy Living Ashwagandha 60 Tabs Free


Product Specification

Weight (kg) 6.0
Price per kg 1066.33
Number of Servings 40
Serving Size 150 g
Calories per Serving 593
Carb per Serving 120 g
Protein per Serving 15 g
Protein Carb Ratio 1/8
Vegetarian/Non-Vegetarian Vegetarian
Carb % per Serving 80.0
Weight 13.2 lb
Flavour Banana & Strawberry + Pharmgrade Healthy Living Ashwagandha 60 Tabs Free
Country of Origin India
Packaging Jar
Brand Origin Indian
Form Powder
Goal Muscle Building,Muscle Recovery
Weight Bucket 13.2
Flavor Base Banana,Strawberry
Serving Bucket 20-40
Calorie Bucket 0-600
Lifestage Adult
Gender Men
Kcal 593
Protein 15 g
Carbs 120 g

Product Ratings & Reviews

Ratings
Reviews
5
4
3
2
1

Customer Comments

No reviews found

Buy the product and add your first ratings & reviews

Similar Products.

8906045142076
Nutrabay
Nutrabay Gold Mighty Mass Gainer, 2.2 lb Chocolate Supreme
Product Details Nutrabay Gold Mighty Mass Gainer is rapid muscle mass / weight gaining formulation 5:1 ratio (82.6g of Carbs | 15.3g of Proteins per serving). It contains a blend of fast and slow-acting protein sources that help in faster muscle recoveryRecommended for active gym goers and elite fitness enthusiasts who strive to gain Muscle Mass & a sturdy physique with a high-calorie formula that helps you meet your increased calorie requirementsUse Nutrabay Gold Mighty Mass Gainer as post-workout and/or between meals to add calories, carbs and protein to your healthy, balanced diet Nutrabay Gold Mighty Mass Gainer, 2.2 lb Chocolate Supreme
Nutrabay Gold Mighty Mass Gainer,  2.2 lb  Chocolate Supreme
8904330004405
Big Flex
Big Flex Essential Mass Gainer, 2.2 lb Chocolate
Product Details Increases Mass: BigFlex Mass Gainer is good for weight gain and muscle building. The supplement will strengthen your muscles and make you more powerful. It provides all the required nutrients to keep you going even while you're pushing yourself beyond your limits in the gym. This dietary supplement will help your muscles get properly nourished and recover faster after a strenuous workout session. That means next time you go to the gym, you'll be able to push yourself harder than ever before!Improves Athletic Performance: BigFlex Muscle Mass Gainer also helps improve athletic performance by supplying necessary proteins and carbohydrates during training sessions. Muscles need carbohydrates to fuel intense workouts. With the help of BigFlex Muscle Mass Gainer, one can work out longer and harder than before. Muscular strength, power, and speed are also improved because of the addition of essential nutrients that act as pre-workout catalysts.Helps Muscles Recover Faster: By accelerating the growth of muscle cells, BigFlex Muscle Mass Gainer helps your muscles recover faster too! Muscles take a few hours to grow and recover, and this supplement will help them do so much faster. That means the next time you hit the gym for a strenuous workout, your muscles will be ready to go in no time! BigFlex Mass Gainer increases ATP production and adenosine triphosphate synthesis. When you feel pain in your muscles after a grueling workout session, take this product immediately. This will help your muscles grow even stronger and make you more powerful. Big Flex Essential Mass Gainer, 2.2 lb Chocolate
Big Flex Essential Mass Gainer,  2.2 lb  Chocolate
AS-IT-IS Nutrition
AS-IT-IS Nutrition Mass Gainer - 1.5kg Combo, 2 Piece(s)/Pack Unflavoured
Product Details Maltodextrin & Whey protein Concentrate 80%The Pure/Authentic Bodybuilding Supplement, Fulfils High-Calorie Requirement, Increases Muscle Power & Weight Gain, Quickly Replenishes Glycogen Stores, Enhances Endurance Capacity & Offers Superior Performance ResultsMix 2 scoops of Pure Carb (maltodextrin) and 1 scoop of Whey Protein Concentrate in 250ml water, stir and drink. You can also consume the blend with milk or your favourite beverages.AS-IT-IS Nutrition Mass Gainer - 1.5kg Combo | Carb & amp; Protein Ratio 2:1| Do-It-Yourself Mass Gainer |Unflavoured| AS-IT-IS Nutrition Mass Gainer - 1.5kg Combo, 2 Piece(s)/Pack Unflavoured
AS-IT-IS Nutrition Mass Gainer - 1.5kg Combo,  2 Piece(s)/Pack  Unflavoured
8908010020723
MightyX
MightyX Super Mass Gainer, 6.6 lb Chocolate
Product Details Perfect Blend For Healthy Weight Gain & Mass Gain: Mighty Super Mass Gainer / Weight Gainer 1kg is a perfect blend of whey and milk Protein fortified with Glutamine, Creatine, Esssential Minerals & Vitamins all of which would provide essential Nutrients for maximum Mass Gain and Weight Gain.Quality Mass Gainer: Consists of superior quality easily absorbable protein delivering muscle-boosting nutrients to the muscles faster and more effectively leading to jacked-up size and strength.Strengthen Muscles: BCAA in it boosts explosive power and strength into the muscles to increase intensity of workouts. MightyX Super Mass Gainer, 6.6 lb Chocolate
MightyX Super Mass Gainer,  6.6 lb  Chocolate
8906115290737
MuscleMonk
MuscleMonk Intense Mass Gainer, 6.6 lb Royal Chocolate
Product Details MASS ENHANCING SUPPLEMENT - Boost your appetite for more! Muscle Monk Intense Gainer helps you put on weight in all the right places. This highest quality gainer delivers a massive 677 calories per serving and protein with quickly digested carbohydrates to support muscle mass.DIETARY ESSENTIALS - Serious athletes need true proper nutrition to ensure growth and weight gain. Muscle Monk Intense Gainer provides healthy fats, fibre, complex carbs, and vitamins to ensure your body has what it needs to grow.SUPER CHARGE YOUR MACROS - Intense Gainer provides 710 kcal, 41.8 grams of protein and 120.3 grams of carbohydrates per serving, and only 1.14 grams of fat. This is essential for any person looking to up their caloric intake. Intense Gainer is suitable for both men and women.100% SATISFACTION GUARANTEE - Muscle Monk is passionate to create supplements with path breaking formulation which also offers 100% assured safety of products, international grade ingredients, impeccable taste, accurately tested, and proudly manufactured in India.DELICIOUS FLAVORS UNLIKE ANYTHING IN THE MARKET - Comes in a variety of delicious flavours and two sizes. Best of all, YOU DON’T NEED TO ADD MILK! That's right, while other products add calories that come from milk, Muscle Monk is PERFECT with just water! Don't settle for a mass gainer that doesn't mix with clean, cold, refreshing water. Muscle Monk Intense Mass Gainer, 6.6 lb Royal Chocolate
MuscleMonk Intense Mass Gainer,  6.6 lb  Royal Chocolate
Matrix Nutrition
Matrix Nutrition Incredi Lean, 2.2 lb Chocolate
Product Details Micronized amino acids help fuel muscles and might support key processes crucial to the growth and repair of musclesGluten-free dietary supplement with zero added sugarGainer is engineered with the ingredients proven to help increase lean muscle mass, weight, strength and endurance. & nbsp;Matrix Nutrition Incredi Lean, 2.2 lb Chocolate
Matrix Nutrition Incredi Lean,  2.2 lb  Chocolate
631656712292
MuscleTech
MuscleTech Mass Tech Extreme 2000, 7 lb Vanilla Milkshake
Product Details MASS TECH has more protein, better calories & bigger results than other mass gainers; Start seeing the results from all your hard work in the gym MASS TECH delivers the protein, carbs, and creatine you need to bulk up, pack on muscle, jack up your strength and finally make the kind of mass gains you've never experienced beforeMORE PROTEIN, BETTER CALORIES & BIGGER RESULTS: Delivers 80 grams Protein, 156 grams Carbs, and 10grams Creatine (with 2 Cups Skim Milk) you need to bulk up, pack on muscle, and jack up your strengthSCIENTIFICALLY TESTED TO RAPIDLY ADD MASS : On average, subjects gained 6.8 pounds of mass, while control subjects gained 1.3 poundsSCIENTIFICALLY TESTED TO INCREASE CHEST & ARM SIZE: Subjects gained 1.2 inches on their chest and 0.5 inches on their arms vs. the control group, which only added 0.5 inches and 0.2 inches MuscleTech Mass Tech Extreme 2000, 7 lb Vanilla Milkshake
MuscleTech Mass Tech Extreme 2000,  7 lb  Vanilla Milkshake
Big Flex
Big Flex LMG(Light Machine Gun) Lean Mass Gainer, 6.6 lb Kesar Badam + Big Flex Shaker Free
Product Details Whey protein concentrate, whey protein isolate, calcium caseinate, skimmed milk powder 35%, cocoa powder, creatine monohydrateHelps to Facilitate Muscle Protein Synthesis.Helps in Muscle Recovery & Growth.Helps to Improve Performance & Strength Big Flex LMG(Light Machine Gun) Lean Mass Gainer, 6.6 lb Kesar Badam + Big Flex Shaker Free
Big Flex LMG(Light Machine Gun) Lean Mass Gainer,  6.6 lb  Kesar Badam + Big Flex Shaker Free
8906031317495
Proathlix
Proathlix High Carb Lean Mass Gainer with Creatine and Tribulus Terrestris Extract, 11 lb Choco Caramel
Product Details HIGH ON NUTRITION: Proathlix Lean Mass Gainer is highly specialized formula to give you the best results. This product is manufactured in FSSC 22000, ISO 22000 & WHO-GMP certified manufacturing facility. This product contains 60 g protein per serving, 200 g of carbohydrate, approx. 1105.50 Kcal energy, therefore you get a balanced nutrients without compromising your health.WHEY IMPORTED FROM THE USA: This product is manufactured using whey protein imported from the USA (International quality) in India so you get the highest quality product. Our high protein gainer also contains MCT for nutritional support & increase performance during workout by providing energy, and increasing lean mass.ADDED VITAMINS AND MINERALS: Proathlix Lean Mass Gainer contains vitamins {Vitamin C (Ascorbic Acid), Vitamin B3 (Niacin), Vitamin E (Tocopherol), Vitamin B5 (Pantothenic Acid), Vitamin B1 (Thiamine), Vitamin B2 (Riboflavin), Vitamin B6 (Pyridoxine)} and minerals (Zinc, Iron and Magnesium). Proathlix High Carb Lean Mass Gainer with Creatine and Tribulus Terrestris Extract, 11 lb Choco Caramel
Proathlix High Carb Lean Mass Gainer with Creatine and Tribulus Terrestris Extract,  11 lb  Choco Caramel
8904330004450
Big Flex
Big Flex Essential Mass Gainer, 11 lb Kesar Badam
Product Details Increases Mass: BigFlex Mass Gainer is good for weight gain and muscle building. The supplement will strengthen your muscles and make you more powerful. It provides all the required nutrients to keep you going even while you're pushing yourself beyond your limits in the gym. This dietary supplement will help your muscles get properly nourished and recover faster after a strenuous workout session. That means next time you go to the gym, you'll be able to push yourself harder than ever before!Improves Athletic Performance: BigFlex Muscle Mass Gainer also helps improve athletic performance by supplying necessary proteins and carbohydrates during training sessions. Muscles need carbohydrates to fuel intense workouts. With the help of BigFlex Muscle Mass Gainer, one can work out longer and harder than before. Muscular strength, power, and speed are also improved because of the addition of essential nutrients that act as pre-workout catalysts.Helps Muscles Recover Faster: By accelerating the growth of muscle cells, BigFlex Muscle Mass Gainer helps your muscles recover faster too! Muscles take a few hours to grow and recover, and this supplement will help them do so much faster. That means the next time you hit the gym for a strenuous workout, your muscles will be ready to go in no time! BigFlex Mass Gainer increases ATP production and adenosine triphosphate synthesis. When you feel pain in your muscles after a grueling workout session, take this product immediately. This will help your muscles grow even stronger and make you more powerful. Big Flex Essential Mass Gainer, 11 lb Kesar Badam
Big Flex Essential Mass Gainer,  11 lb  Kesar Badam
Absolute Nutrition
Absolute Nutrition Mass Gainer, 2.2 lb Cream & Cookies
Product Details Absolute Nutrition Muscle Meal 2kg chocolate is an internationally sourced Whey Protein supplementThe perfect blend of protein and carbohydrate with a ratio of 1:1 formulates Muscle meal chocolateMuscle meal comprises of 1g creatine, monohydrate, 1g BCAAs and 1g Tribulus Terrestris per serving Absolute Nutrition Mass Gainer, 2.2 lb Cream & amp; Cookies
Absolute Nutrition Mass Gainer,  2.2 lb  Cream & Cookies
8906059343629
Maxn
Maxn Mass Gainer, 3.3 lb Mango
Product Details Supplements Weight GainSupplements Muscle GrowthHigh Protein and Carb FormulaNot to Exceed the Suggested Daily UsageHealth Supplements not to be used as a substitute for a varied diet Maxn Mass Gainer, 3.3 lb Mango
Maxn Mass Gainer,  3.3 lb  Mango
8906059343650
Maxn
Maxn Mass Gainer, 11 lb Mango
Product Details Supplements Weight GainSupplements Muscle GrowthHigh Protein and Carb FormulaNot to Exceed the Suggested Daily UsageHealth Supplements not to be used as a substitute for a varied diet Maxn Mass Gainer, 11 lb Mango
Maxn Mass Gainer,  11 lb  Mango
OneLife
OneLife Mass Gainer for Lean Mass & Muscle Gain, 6.6 lb Swiss Chocolate
Product Details Onelife Mass Gainer is a superior formulation that is designed to provide high-quality protein for muscle mass gain as well as the sustained release of carbohydrates that support your high-intensity workoutsWith a 2.5:1 ratio of Carbohydrates to Protein respectively, it supports lean mass gain without excess fat gainIt has the ideal composition of carbs and protein along with creatine to help you build muscle and mass togetherIt also includes an MCT fat source and an 8g Amino matrix with 27 micronutrientsOptimally dosed micronutrients to boost immunity and enhance exercise performance OneLife Mass Gainer, 6.6 lb Swiss Chocolate
OneLife Mass Gainer for Lean Mass & Muscle Gain,  6.6 lb  Swiss Chocolate
6189332653925
HealthXP
HealthXP Mass Gainer, 2.2 lb Chocolate
Product Details 23g protein per serving4g Glutamine and 115g CarbsPowerful weight gaining formula HealthXP Mass Gainer, 2.2 lb Chocolate
HealthXP Mass Gainer,  2.2 lb  Chocolate
8906001721772
Proquest
Proquest Lean Mass, 11 lb Milk Chocolate
Product Details Informed Choice trusted by Sport25 Vitamins & MineralsProbiotic FoodProquest Lean Mass, 11 lb Milk Chocolate
Proquest Lean Mass,  11 lb  Milk Chocolate
8906133022228
Nakpro
Nakpro Gold Mass Gainer, 2.2 lb Cookies & Cream (Pack of 2)
Product Details NAKPRO GOLD MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. HIGH-CALORIE: Nakpro Gold Mass Gainer is specially formulated for fitness enthusiasts who strive to gain muscle mass & amp; physique. It has high-calorie formula that helps you meet your daily calories requirements. RICH & amp; PURE INGREDIENTS: Gold Mass Gainer is rapid mass gainer with 1:3 ratio offers you 21.6 grams of protein derived from three quality sources and 68.6 grams of carbs that work jointly to optimize the glycogen levels and provide energy for the workout. Receive a sustained release of calories to fuel your muscles for long hours offering 372 kcal per serving. DELICIOUS FLAVOURS: Nakpro Gold Mass Gainer is available in Wide range of flavours. Taste with the goodness of gainer drink to reach your fitness goals with ease and weight gain. LEAN MUSCLE MASS GAIN WITH NO SIDE EFFECTS: Nakpro gold mass gainer protein powder is loaded with High Calories, Healthy Fat, BCAAs that help build lean muscles and improve your exercise performance. It is enriched with 27 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-free. DIRECTION OF USAGE: Mix 1 level scoop (100 gm) in 200ml water. before a workout for the best results. Recommended to use post-workout and/or between meals to add calories, carbs and protein to your diet.
Nakpro Gold Mass Gainer,  2.2 lb  Cookies & Cream (Pack of 2)
8906133022068
Nakpro
Nakpro Gold Mass Gainer, 2.2 lb Strawberry (Pack of 2)
Product Details NAKPRO GOLD MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. HIGH-CALORIE: Nakpro Gold Mass Gainer is specially formulated for fitness enthusiasts who strive to gain muscle mass & amp; physique. It has high-calorie formula that helps you meet your daily calories requirements. RICH & amp; PURE INGREDIENTS: Gold Mass Gainer is rapid mass gainer with 1:3 ratio offers you 21.6 grams of protein derived from three quality sources and 68.6 grams of carbs that work jointly to optimize the glycogen levels and provide energy for the workout. Receive a sustained release of calories to fuel your muscles for long hours offering 372 kcal per serving. DELICIOUS FLAVOURS: Nakpro Gold Mass Gainer is available in Wide range of flavours. Taste with the goodness of gainer drink to reach your fitness goals with ease and weight gain. LEAN MUSCLE MASS GAIN WITH NO SIDE EFFECTS: Nakpro gold mass gainer protein powder is loaded with High Calories, Healthy Fat, BCAAs that help build lean muscles and improve your exercise performance. It is enriched with 27 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-free. DIRECTION OF USAGE: Mix 1 level scoop (100 gm) in 200ml water. before a workout for the best results. Recommended to use post-workout and/or between meals to add calories, carbs and protein to your diet.
Nakpro Gold Mass Gainer,  2.2 lb  Strawberry (Pack of 2)
MuscleBlaze
MuscleBlaze Mass Gainer XXL OP, 6.6 lb Chocolate
Product Details Product is near expiry date,Cancellations & returns are not acceptedMuscleBlaze Mass Gainer XXL Chocolate fuels your body with 82.5g protein and 1383 calories in a ratio of 1:3 when you consume 3 servings of 100g each with 300ml milk and carry out intense workout sessionsIt helps in muscle building and repairing through its unique blend of slow, medium and fast-reacting proteins. MuscleBlaze Mass Gainer XXL - The secret to having faster gains MuscleBlaze Mass Gainer XXL is crafted especially for fitness lovers who want to gain sturdy muscles. This unique formula offers you 70g carbs per serving that helps in rapid gains. These carbs fuel your body with a sustained calorie supply and boost your energy to fuel your muscle-building throughout the day. MuscleBlaze Mass Gainer XXL has a perfect blend of slow, medium and fast-reacting proteins that enable speedy muscle recovery and maximize muscle size. The product is also fortified with 27 essential vitamins and minerals and a great blend of digestive enzymes that help in better absorption of nutrients and achieve the best results.
MuscleBlaze Mass Gainer XXL OP,  6.6 lb  Chocolate
8904330004405
Big Flex
Big Flex Essential Mass Gainer, 2.2 lb Chocolate Pack of 3
Product Details BigFlex's Essential Mass Gainer is good for weight gain and muscle building. The supplement helps to strengthen your muscles which in turn helps in giving them power to lift heavier weights & train betterBigFlex's Essential Muscle Mass Gainer also helps to improve athletic performance by supplying the necessary proteins and carbohydrates during training sessions.By accelerating the growth of muscle cells, BigFlex’s Essential Muscle Mass Gainer helps your muscles recover faster too! Muscles may take a few hours to grow and recover, and this supplement will help them do so, much faster. Big Flex Essential Mass Gainer, 2.2 lb Chocolate Pack of 3
Big Flex Essential Mass Gainer,  2.2 lb  Chocolate Pack of 3
8906147470039
Core Nutrition
Core Nutrition Extreme Mass Gainer, 6.6 lb Chocolate
Product Details Anabolic Mass Gainer by Core Nutrition is the perfect blended formula of protein, vitamins and creatine.Its quality composition of carbs has a high absorption rate which mixes instantly, promotes rapid muscle growth and helps in sustainable weight gain.It's the most balanced gainer enriched with highly superior vitamins and minerals which takes the weight + muscle gaining process to the next level. Extreme Mass Gainer possesses a balanced blend of high-quality proteins, fats, vitamins, minerals, and carbohydrates that can be suitably consumed by both males as well as females for healthy weight gain. & nbsp; & nbsp; Mass gainer help you boost your immune system and meet the needed dosage of minerals and vitamins required to carry out your regular activity. Enriched with required nutrients, it is an absolute choice for an individual looking forward to helping boost energy, weight, muscle mass, stamina and also helps to improve metabolism and concentration. & nbsp; & nbsp; & nbsp;
Core Nutrition Extreme Mass Gainer,  6.6 lb  Chocolate
8906147470046
Core Nutrition
Core Nutrition Extreme Mass Gainer, 11 lb Chocolate
Product Details Anabolic Mass Gainer by Core Nutrition is the perfect blended formula of protein, vitamins and creatine.Its quality composition of carbs has a high absorption rate which mixes instantly, promotes rapid muscle growth and helps in sustainable weight gain.Its the most balanced gainer enriched with highly superior vitamins and minerals which takes the weight + muscle gaining process to the next level. Extreme Mass Gainer possesses a balanced blend of high-quality proteins, fats, vitamins, minerals, and carbohydrates that can be suitably consumed by both males as well as females for healthy weight gain. & nbsp;
Core Nutrition Extreme Mass Gainer,  11 lb  Chocolate
627933026565
Mutant
Mutant Mass Gainer, 15 lb Triple Chocolate
Product Details Mutant Mass Gainer 15 lb Triple Chocolate is an advanced mass gain formula that is assembled for absurd gains in muscle massIt is a full dose of protein that comes loaded with clean carbohydrates and critical fatsThis supplement aids to provide essential amino acids and branched chain amino acids to support serious weight training, rapid recovery and assists to build lean muscle massIt contains over 100 calories from 10 proteins, waxy maize, MCTs and more per servingMutant Mass Gainer Triple Chocolate contains 52 grams of protein and 32 grams of BCAAs + EAAs + Glutamine/Glutamine Precursors Mutant Mass Gainer 15 lb Triple Chocolate is a revolutionary muscle mass gainer that aids to provide extreme mass building results. Each and every serving of Mutant Mass comes loaded with the same amount of strength and power to provide a powerful dose of macro nutrients including a shift to your body to limitless growth. & nbsp; Benefits Mutant Mass Gainer Chocolate aids to supply Essential Amino Acids and Branched Chain Amino Acids to assist in rapid recovery, effective weight training and build lean muscle mass. Produced after countless hours of research and testing, it is an absolute advanced muscle mass gainer that aids to deliver extreme mass building results. If you are spending a lot of hours sweating in the gym to build massive muscle and get extreme strength, then Mutant Mass is a must have product for your mass building goals. Ingredients Waxy Maize Starch, Maltodextrin, Mutant Mass 10-Protein Matrix (Whey Protein Concentrate, NitroSerum Whey Protein Concentrate, Whey Protein Isolate, Milk Protein Concentrate [Source of 80% Micellar Casein/20% Whey Proteins], Egg Albumen, Whey Protein Hydrolysate, Micellar Casein, Calcium Caseinate, Milk Protein Isolate, Sodium Caseinate: Contains Soy Lecithin [Emulsifier]), Cocoa (Processed with Alkali), Thickeners (Defatted Soybean, Inulin, Gura Gum, Oat Powder), MCT Oil and Sunflower Oil Powders (Coconut Oil, Sunflower Seed Oil, Corn Syrup Solids, Sodium Caseinate, Dipotassium Phosphate, Cane Sugar, Mono and Diglycerides, Sodium Silicoaluminate, Polysorbate 80, Tetrasodium Pyrophosphate, Soy Lecithin), Dextrose, Waxy Barley Starch, Glutamine Peptide (from Wheat), Vanillin, Natural Flavours, Sucralose, Cinnulin Cinnamon Extract, Flax Seed Powder, Colostrum Contains: Milk, egg, wheat, and soy. Produced on machinery that also handles ingredients from fish, crustacean shellfish, tree nuts, peanuts, and sulfites - This product may inadvertently contain any of those ingredients. (Proportions indicated are subject to change) Directions Mix or Shake 4 scoops of Mutant Mass Gainer 15 lb Triple Chocolate into 16 to 32 fluid ounces of cold water or milk. You can enjoy Mutant Mass two or three times a day. For individuals who have a hard time consuming all 4 scoops in one sitting, you can easily split your shake into two shakes using two scoops each. You should take one shake first thing in the morning. If you have a training day it is a good idea to take another shake of Mutant Mass right after training.
Mutant Mass Gainer,  15 lb  Triple Chocolate
8906133022242
Nakpro
Nakpro Gold Mass Gainer, 2.2 lb Chocolate Cream (Pack of 2)
Product Details NAKPRO GOLD MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. HIGH-CALORIE: Nakpro Gold Mass Gainer is specially formulated for fitness enthusiasts who strive to gain muscle mass & amp; physique. It has high-calorie formula that helps you meet your daily calories requirements. RICH & amp; PURE INGREDIENTS: Gold Mass Gainer is rapid mass gainer with 1:3 ratio offers you 21.6 grams of protein derived from three quality sources and 68.6 grams of carbs that work jointly to optimize the glycogen levels and provide energy for the workout. Receive a sustained release of calories to fuel your muscles for long hours offering 372 kcal per serving. DELICIOUS FLAVOURS: Nakpro Gold Mass Gainer is available in Wide range of flavours. Taste with the goodness of gainer drink to reach your fitness goals with ease and weight gain. LEAN MUSCLE MASS GAIN WITH NO SIDE EFFECTS: Nakpro gold mass gainer protein powder is loaded with High Calories, Healthy Fat, BCAAs that help build lean muscles and improve your exercise performance. It is enriched with 27 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-free. DIRECTION OF USAGE: Mix 1 level scoop (100 gm) in 200ml water. before a workout for the best results. Recommended to use post-workout and/or between meals to add calories, carbs and protein to your diet.
Nakpro Gold Mass Gainer,  2.2 lb  Chocolate Cream (Pack of 2)
8906133022037
Nakpro
Nakpro Gold Mass Gainer, 2.2 lb Banana (Pack of 5)
Product Details NAKPRO GOLD MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. & nbsp; HIGH-CALORIE: Nakpro Gold Mass Gainer is specially formulated for fitness enthusiasts who strive to gain muscle mass & amp; physique. It has high-calorie formula that helps you meet your daily calories requirements. RICH & amp; PURE INGREDIENTS: Gold Mass Gainer is rapid mass gainer with 1:3 ratio offers you 21.6 grams of protein derived from three quality sources and 68.6 grams of carbs that work jointly to optimize the glycogen levels and provide energy for the workout. Receive a sustained release of calories to fuel your muscles for long hours offering 372 kcal per serving. DELICIOUS FLAVOURS: Nakpro Gold Mass Gainer is available in Wide range of flavours. Taste with the goodness of gainer drink to reach your fitness goals with ease and weight gain. LEAN MUSCLE MASS GAIN WITH NO SIDE EFFECTS: Nakpro gold mass gainer protein powder is loaded with High Calories, Healthy Fat, BCAAs that help build lean muscles and improve your exercise performance. It is enriched with 27 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-free. DIRECTION OF USAGE: Mix 1 level scoop (100 gm) in 200ml water. before a workout for the best results. Recommended to use post-workout and/or between meals to add calories, carbs and protein to your diet.
Nakpro Gold Mass Gainer,  2.2 lb  Banana (Pack of 5)
8906133022006
Nakpro
Nakpro Gold Mass Gainer, 2.2 lb Coffee (Pack of 2)
Product Details NAKPRO GOLD MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. HIGH-CALORIE: Nakpro Gold Mass Gainer is specially formulated for fitness enthusiasts who strive to gain muscle mass & amp; physique. It has high-calorie formula that helps you meet your daily calories requirements. RICH & amp; PURE INGREDIENTS: Gold Mass Gainer is rapid mass gainer with 1:3 ratio offers you 21.6 grams of protein derived from three quality sources and 68.6 grams of carbs that work jointly to optimize the glycogen levels and provide energy for the workout. Receive a sustained release of calories to fuel your muscles for long hours offering 372 kcal per serving. DELICIOUS FLAVOURS: Nakpro Gold Mass Gainer is available in Wide range of flavours. Taste with the goodness of gainer drink to reach your fitness goals with ease and weight gain. LEAN MUSCLE MASS GAIN WITH NO SIDE EFFECTS: Nakpro gold mass gainer protein powder is loaded with High Calories, Healthy Fat, BCAAs that help build lean muscles and improve your exercise performance. It is enriched with 27 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-free. DIRECTION OF USAGE: Mix 1 level scoop (100 gm) in 200ml water. before a workout for the best results. Recommended to use post-workout and/or between meals to add calories, carbs and protein to your diet.
Nakpro Gold Mass Gainer,  2.2 lb  Coffee (Pack of 2)
8906133022433
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Chocolate (Pack of 5)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Chocolate (Pack of 5)
Nakpro Perform Mass Gainer,  2.2 lb  Chocolate (Pack of 5)
8906133022440
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Coffee
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Coffee
Nakpro Perform Mass Gainer,  2.2 lb  Coffee
8906133022457
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Coffee (Pack of 2)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Coffee (Pack of 2)
Nakpro Perform Mass Gainer,  2.2 lb  Coffee (Pack of 2)
8906133022471
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Coffee (Pack of 5)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Coffee (Pack of 5)
Nakpro Perform Mass Gainer,  2.2 lb  Coffee (Pack of 5)
8906133022464
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Coffee (Pack of 3)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Coffee (Pack of 3)
Nakpro Perform Mass Gainer,  2.2 lb  Coffee (Pack of 3)
8906133022488
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Cookies & Cream
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Cookies & amp; Cream
Nakpro Perform Mass Gainer,  2.2 lb  Cookies & Cream
8906133022518
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Cookies & Cream (Pack of 5)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Cookies & amp; Cream (Pack of 5)
Nakpro Perform Mass Gainer,  2.2 lb  Cookies & Cream (Pack of 5)
8906133022532
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Chocolate Cream (Pack of 2)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Chocolate Cream (Pack of 2)
Nakpro Perform Mass Gainer,  2.2 lb  Chocolate Cream (Pack of 2)
8906133022563
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Banana
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Banana
Nakpro Perform Mass Gainer,  2.2 lb  Banana
8906133022549
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Chocolate Cream (Pack of 3)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Chocolate Cream (Pack of 3)
Nakpro Perform Mass Gainer,  2.2 lb  Chocolate Cream (Pack of 3)
8906133022570
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Banana (Pack of 2)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Banana (Pack of 2)
Nakpro Perform Mass Gainer,  2.2 lb  Banana (Pack of 2)
8906001721703
Proquest
Proquest Lean Mass, 6.6 lb Banana
Product Details Informed Choice trusted by Sport25 Vitamins & MineralsProbiotic FoodProquest Lean Mass, 6.6 lb Banana
Proquest Lean Mass,  6.6 lb  Banana
8906133022600
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Mango
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Mango
Nakpro Perform Mass Gainer,  2.2 lb  Mango
8906133022624
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Mango (Pack of 3)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Mango (Pack of 3)
Nakpro Perform Mass Gainer,  2.2 lb  Mango (Pack of 3)
8906133022631
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Mango (Pack of 5)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Mango (Pack of 5)
Nakpro Perform Mass Gainer,  2.2 lb  Mango (Pack of 5)
8906133022648
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Strawberry
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Strawberry
Nakpro Perform Mass Gainer,  2.2 lb  Strawberry
8906133022662
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Strawberry (Pack of 3)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Strawberry (Pack of 3)
Nakpro Perform Mass Gainer,  2.2 lb  Strawberry (Pack of 3)
8906133022686
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Vanilla
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Vanilla
Nakpro Perform Mass Gainer,  2.2 lb  Vanilla
8906133022679
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Strawberry (Pack of 5)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Strawberry (Pack of 5)
Nakpro Perform Mass Gainer,  2.2 lb  Strawberry (Pack of 5)
8906133022709
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Vanilla (Pack of 3)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Vanilla (Pack of 3)
Nakpro Perform Mass Gainer,  2.2 lb  Vanilla (Pack of 3)
8906133022716
Nakpro
Nakpro Perform Mass Gainer, 2.2 lb Vanilla (Pack of 5)
Product Details NAKPRO PERFORM MASS GAINER: Is a high calorie and high protein mass gainer having complex carbohydrate with balanced blend of protein from three source. It helps gain healthy muscle mass, enhance recovery, supports healthy metabolism and also provide additional strength & energy during workout. 100% Genuine, clean product. Laboratory tested and certified for purity. Quality assured and authenticity guaranteed.PACKED WITH 23 VITAMINS & MINERALS: NAKPRO PERFORM MASS GAINER is enriched with 23 vitamins and minerals that help in boosting immunity and provide performance fuel to conquer your workout. It contains no added sugar and is trans-fat-freeSUPPORTS MUSCLE HEALTH AS WE AGE: As we age, it’s important to consume high quality complete proteins, like PERFORM MASS GAINER to help support optimal muscle health. Specially formulated for bodybuilders, weight training athletes, fitness champions and gym enthusiasts, build lean muscles, boost recovery, and reduce muscle loss. Nakpro Perform Mass Gainer, 2.2 lb Vanilla (Pack of 5)
Nakpro Perform Mass Gainer,  2.2 lb  Vanilla (Pack of 5)